Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein GTP-binding protein RheB [142275] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries) Uniprot Q15382 3-169 |
Domain d6bt0a1: 6bt0 A:3-169 [349850] Other proteins in same PDB: d6bt0a2, d6bt0b2, d6bt0c2, d6bt0d2 automated match to d3t5ga_ complexed with e7v, gdp, mg |
PDB Entry: 6bt0 (more details), 2.6 Å
SCOPe Domain Sequences for d6bt0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bt0a1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek
Timeline for d6bt0a1: