Lineage for d3t5ga_ (3t5g A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475404Protein GTP-binding protein RheB [142275] (2 species)
  7. 2475405Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
    Uniprot Q15382 3-169
  8. 2475412Domain d3t5ga_: 3t5g A: [185648]
    Other proteins in same PDB: d3t5gb_
    automated match to d1xtqa1
    complexed with far, gdp, mg

Details for d3t5ga_

PDB Entry: 3t5g (more details), 1.7 Å

PDB Description: structure of fully modified farnesylated rheb in complex with pde6d
PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d3t5ga_:

Sequence, based on SEQRES records: (download)

>d3t5ga_ c.37.1.8 (A:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaekmdgacsqgkssc

Sequence, based on observed residues (ATOM records): (download)

>d3t5ga_ c.37.1.8 (A:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvipimlvgnkkdlhm
ervisyeegkalaeswnaaflessakenqtavdvfrriileaekmqgkssc

SCOPe Domain Coordinates for d3t5ga_:

Click to download the PDB-style file with coordinates for d3t5ga_.
(The format of our PDB-style files is described here.)

Timeline for d3t5ga_: