Lineage for d6bt0c1 (6bt0 C:3-169)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475404Protein GTP-binding protein RheB [142275] (2 species)
  7. 2475405Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
    Uniprot Q15382 3-169
  8. 2475427Domain d6bt0c1: 6bt0 C:3-169 [349871]
    Other proteins in same PDB: d6bt0a2, d6bt0b2, d6bt0c2, d6bt0d2
    automated match to d3t5ga_
    complexed with e7v, gdp, mg

Details for d6bt0c1

PDB Entry: 6bt0 (more details), 2.6 Å

PDB Description: crystal structure of rheb in complex with compound nr1
PDB Compounds: (C:) GTP-binding protein Rheb

SCOPe Domain Sequences for d6bt0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bt0c1 c.37.1.8 (C:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

SCOPe Domain Coordinates for d6bt0c1:

Click to download the PDB-style file with coordinates for d6bt0c1.
(The format of our PDB-style files is described here.)

Timeline for d6bt0c1: