SCOPe 2.08: Domain d6bt0a1: 6bt0 A:3-169

Lineage for d6bt0a1 (6bt0 A:3-169)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein RheB [142275] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
   Uniprot Q15382 3-169

8. Domain d6bt0a1: 6bt0 A:3-169 [349850]
   Other proteins in same PDB: d6bt0a2, d6bt0b2, d6bt0c2, d6bt0d2
   automated match to d3t5ga_
   complexed with e7v, gdp, mg

Details for d6bt0a1

PDB Entry: 6bt0, 2.6 Å

PDB Description: crystal structure of rheb in complex with compound nr1

PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d6bt0a1:

Sequence; same for both SEQRES and ATOM records:

>d6bt0a1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

Timeline for d6bt0a1:

• d6bt0a1 first appeared in SCOPe 2.07