Lineage for d5ol4b_ (5ol4 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) 
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) Protein Urease, beta-subunit [51280] (4 species) Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries) 
Domain d5ol4b_: 5ol4 B: [347283]
Other proteins in same PDB: d5ol4a_
automated match to d2ubpb_
complexed with 9xn, edo, ni, so4
Details for d5ol4b_
PDB Entry: 5ol4 (more details), 1.28 Å
PDB Description: 1.28 a resolution of sporosarcina pasteurii urease inhibited in the presence of nbpt
PDB Compounds: (B:) urease subunit betaSCOPe Domain Sequences for d5ol4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ol4b_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve
SCOPe Domain Coordinates for d5ol4b_:
Click to download the PDB-style file with coordinates for d5ol4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ol4b_:
- d5ol4b_ first appeared in SCOPe 2.07
View in 3D
