PDB entry 5ol4

View 5ol4 on RCSB PDB site
Description: 1.28 A resolution of Sporosarcina pasteurii urease inhibited in the presence of NBPT
Class: hydrolase
Keywords: Urease Nickel NBPT enzyme, HYDROLASE
Deposited on 2017-07-26, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Urease subunit gamma
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YGY5 (0-99)
  Domains in SCOPe 2.08: d5ol4a_
• Chain 'B':
  Compound: urease subunit beta
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41021 (0-121)
  Domains in SCOPe 2.08: d5ol4b_
• Chain 'C':
  Compound: urease subunit alpha
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YL32 (0-569)
• Heterogens: 9XN, EDO, SO4, NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ol4A (A:)
  mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
  khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ol4B (B:)
  nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
  rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
  ve
  

  
  
• Chain 'C':
  No sequence available.