Lineage for d5mz2d2 (5mz2 D:154-484)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838932Species Thalassiosira antarctica [TaxId:555753] [346600] (1 PDB entry)
  8. 2838936Domain d5mz2d2: 5mz2 D:154-484 [346949]
    Other proteins in same PDB: d5mz2a1, d5mz2b1, d5mz2c1, d5mz2d1, d5mz2e1, d5mz2f1, d5mz2g1, d5mz2h1, d5mz2i_, d5mz2j_, d5mz2k_, d5mz2l_, d5mz2m_, d5mz2n_, d5mz2o_, d5mz2p_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d5mz2d2

PDB Entry: 5mz2 (more details), 1.9 Å

PDB Description: rubisco from thalassiosira antarctica
PDB Compounds: (D:) Rubisco large subunit

SCOPe Domain Sequences for d5mz2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mz2d2 c.1.14.1 (D:154-484) automated matches {Thalassiosira antarctica [TaxId: 555753]}
gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq
pfmrwrerflncleginraaaatgevkgsylnitaatmeevykraeyakaigsvvvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvaleamvlarnegadyfnnqvgpqilrda
aktcgplqtaldlwkdisfnytstdtadfae

SCOPe Domain Coordinates for d5mz2d2:

Click to download the PDB-style file with coordinates for d5mz2d2.
(The format of our PDB-style files is described here.)

Timeline for d5mz2d2: