Lineage for d5mz2f1 (5mz2 F:4-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953261Species Thalassiosira antarctica [TaxId:555753] [346598] (1 PDB entry)
  8. 2953267Domain d5mz2f1: 5mz2 F:4-153 [346793]
    Other proteins in same PDB: d5mz2a2, d5mz2b2, d5mz2c2, d5mz2d2, d5mz2e2, d5mz2f2, d5mz2g2, d5mz2h2, d5mz2i_, d5mz2j_, d5mz2k_, d5mz2l_, d5mz2m_, d5mz2n_, d5mz2o_, d5mz2p_
    automated match to d1bwva2
    complexed with cap, edo, mg

Details for d5mz2f1

PDB Entry: 5mz2 (more details), 1.9 Å

PDB Description: rubisco from thalassiosira antarctica
PDB Compounds: (F:) Rubisco large subunit

SCOPe Domain Sequences for d5mz2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mz2f1 d.58.9.0 (F:4-153) automated matches {Thalassiosira antarctica [TaxId: 555753]}
svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
iignvfgfkaisalrledmriphsylxtfq

SCOPe Domain Coordinates for d5mz2f1:

Click to download the PDB-style file with coordinates for d5mz2f1.
(The format of our PDB-style files is described here.)

Timeline for d5mz2f1: