SCOPe 2.08: Domain d3h4pf_: 3h4p F:

Lineage for d3h4pf_ (3h4p F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Methanocaldococcus jannaschii [TaxId:2190] [346387] (1 PDB entry)
   3h4p lower case chains a-g are beta subunits; not included because sids are not case sensitive

8. Domain d3h4pf_: 3h4p F: [344767]
   Other proteins in same PDB: d3h4ph_, d3h4pi_, d3h4pj_, d3h4pk_, d3h4pl_, d3h4pm_, d3h4pn_

Details for d3h4pf_

PDB Entry: 3h4p, 4.1 Å

PDB Description: proteasome 20s core particle from methanocaldococcus jannaschii

PDB Compounds: (F:) Proteasome subunit alpha

SCOPe Domain Sequences for d3h4pf_:

Sequence; same for both SEQRES and ATOM records:

>d3h4pf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Methanocaldococcus jannaschii [TaxId: 2190]}
itvfspegrlyqveyareavrrgttaigiackdgvvlavdrritsklvkirsiekifqid
dhvaaatsglvadarvlidrarleaqiyrltygeeisiemlakkicdikqaytqhggvrp
fgvslliagidknearlfetdpsgalieykataigsgrpvvmellekeyrdditldegle
laitaltkanedikpenvdvciitvkdaqfkkipveeikkliekvkkklnee

Timeline for d3h4pf_:

• d3h4pf_ first appeared in SCOPe 2.07