Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Methanocaldococcus jannaschii [TaxId:2190] [346387] (1 PDB entry) 3h4p lower case chains a-g are beta subunits; not included because sids are not case sensitive |
Domain d3h4pb_: 3h4p B: [344763] Other proteins in same PDB: d3h4ph_, d3h4pi_, d3h4pj_, d3h4pk_, d3h4pl_, d3h4pm_, d3h4pn_ |
PDB Entry: 3h4p (more details), 4.1 Å
SCOPe Domain Sequences for d3h4pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h4pb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Methanocaldococcus jannaschii [TaxId: 2190]} itvfspegrlyqveyareavrrgttaigiackdgvvlavdrritsklvkirsiekifqid dhvaaatsglvadarvlidrarleaqiyrltygeeisiemlakkicdikqaytqhggvrp fgvslliagidknearlfetdpsgalieykataigsgrpvvmellekeyrdditldegle laitaltkanedikpenvdvciitvkdaqfkkipveeikkliekvkkklnee
Timeline for d3h4pb_: