Lineage for d4c2mx1 (4c2m X:2-64)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036360Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 3036361Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 3036419Protein RNA polymerase I subunit A12.2 [346126] (1 species)
    contains two differently decorated domains of this fold
  7. 3036420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346434] (2 PDB entries)
  8. 3036423Domain d4c2mx1: 4c2m X:2-64 [343933]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2my_, d4c2mz_
    automated match to d4c3hi1
    complexed with so4, zn

Details for d4c2mx1

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (X:) DNA-directed RNA polymerase I subunit rpa12

SCOPe Domain Sequences for d4c2mx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mx1 g.41.3.1 (X:2-64) RNA polymerase I subunit A12.2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpsslr
akk

SCOPe Domain Coordinates for d4c2mx1:

Click to download the PDB-style file with coordinates for d4c2mx1.
(The format of our PDB-style files is described here.)

Timeline for d4c2mx1: