Lineage for d4c2me1 (4c2m E:4-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882964Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2882965Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2882966Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 2882967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2882974Domain d4c2me1: 4c2m E:4-143 [228423]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d1twfe1
    complexed with so4, zn

Details for d4c2me1

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d4c2me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2me1 c.52.3.1 (E:4-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
enernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqan
pteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamkl
vpsippatietfneaalvvn

SCOPe Domain Coordinates for d4c2me1:

Click to download the PDB-style file with coordinates for d4c2me1.
(The format of our PDB-style files is described here.)

Timeline for d4c2me1: