Lineage for d5wejb_ (5wej B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407327Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)
  8. 2407341Domain d5wejb_: 5wej B: [342884]
    automated match to d2fyqa_
    complexed with v45

Details for d5wejb_

PDB Entry: 5wej (more details), 1.95 Å

PDB Description: 1.95 a resolution structure of norovirus 3cl protease in complex with a dipeptidyl oxazolidinone-based inhibitor
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5wejb_:

Sequence, based on SEQRES records: (download)

>d5wejb_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records): (download)

>d5wejb_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
glgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

SCOPe Domain Coordinates for d5wejb_:

Click to download the PDB-style file with coordinates for d5wejb_.
(The format of our PDB-style files is described here.)

Timeline for d5wejb_: