Lineage for d2fyqa_ (2fyq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407151Protein Norwalk-like virus processing protease [310746] (2 species)
    Pfam PF05416; 3C-like according to PubMed 16227288
  7. 2407157Species Norwalk virus [TaxId:11983] [311000] (2 PDB entries)
  8. 2407158Domain d2fyqa_: 2fyq A: [303902]
    complexed with cl, po4

Details for d2fyqa_

PDB Entry: 2fyq (more details), 1.5 Å

PDB Description: Crystal Structure of the Norwalk Virus Protease
PDB Compounds: (A:) Chymotrypsin-like cysteine proteinase

SCOPe Domain Sequences for d2fyqa_:

Sequence, based on SEQRES records: (download)

>d2fyqa_ b.47.1.4 (A:) Norwalk-like virus processing protease {Norwalk virus [TaxId: 11983]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetal
e

Sequence, based on observed residues (ATOM records): (download)

>d2fyqa_ b.47.1.4 (A:) Norwalk-like virus processing protease {Norwalk virus [TaxId: 11983]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetale

SCOPe Domain Coordinates for d2fyqa_:

Click to download the PDB-style file with coordinates for d2fyqa_.
(The format of our PDB-style files is described here.)

Timeline for d2fyqa_: