Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Norwalk-like virus processing protease [310746] (2 species) Pfam PF05416; 3C-like according to PubMed 16227288 |
Species Norwalk virus [TaxId:11983] [311000] (2 PDB entries) |
Domain d2fyqa_: 2fyq A: [303902] complexed with cl, po4 |
PDB Entry: 2fyq (more details), 1.5 Å
SCOPe Domain Sequences for d2fyqa_:
Sequence, based on SEQRES records: (download)
>d2fyqa_ b.47.1.4 (A:) Norwalk-like virus processing protease {Norwalk virus [TaxId: 11983]} apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetal e
>d2fyqa_ b.47.1.4 (A:) Norwalk-like virus processing protease {Norwalk virus [TaxId: 11983]} apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm lltipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetale
Timeline for d2fyqa_: