![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains) |
![]() | Protein automated matches [190384] (19 species) not a true protein |
![]() | Species Norwalk virus [TaxId:524364] [313606] (11 PDB entries) |
![]() | Domain d5wejb_: 5wej B: [342884] automated match to d2fyqa_ complexed with v45 |
PDB Entry: 5wej (more details), 1.95 Å
SCOPe Domain Sequences for d5wejb_:
Sequence, based on SEQRES records: (download)
>d5wejb_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]} tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq
>d5wejb_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]} tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt glgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq
Timeline for d5wejb_: