SCOPe 2.07: Domain d5weja_: 5wej A:

Lineage for d5weja_ (5wej A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)

8. Domain d5weja_: 5wej A: [342919]
   automated match to d2fyqa_
   complexed with v45

Details for d5weja_

PDB Entry: 5wej, 1.95 Å

PDB Description: 1.95 a resolution structure of norovirus 3cl protease in complex with a dipeptidyl oxazolidinone-based inhibitor

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5weja_:

Sequence, based on SEQRES records:

>d5weja_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records):

>d5weja_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqrlvhgqsgml
ltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Timeline for d5weja_:

• d5weja_ first appeared in SCOPe 2.06
  
• d5weja_ appears in the current release, SCOPe 2.08