Lineage for d5ty5e_ (5ty5 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790736Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2790831Species Thermococcus thioreducens [TaxId:277988] [346243] (2 PDB entries)
  8. 2790839Domain d5ty5e_: 5ty5 E: [341891]
    automated match to d3q5va_
    complexed with dod

Details for d5ty5e_

PDB Entry: 5ty5 (more details), 2.3 Å

PDB Description: neutron structure from microgravity-grown crystals of inorganic pyrophosphatase from thermococcus theoreducens
PDB Compounds: (E:) inorganic pyrophosphatase

SCOPe Domain Sequences for d5ty5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ty5e_ b.40.5.1 (E:) Inorganic pyrophosphatase {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekf

SCOPe Domain Coordinates for d5ty5e_:

Click to download the PDB-style file with coordinates for d5ty5e_.
(The format of our PDB-style files is described here.)

Timeline for d5ty5e_: