Lineage for d5tpsb2 (5tps B:340-444)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (889 PDB entries)
  8. 2297311Domain d5tpsb2: 5tps B:340-444 [340612]
    Other proteins in same PDB: d5tpsa1, d5tpsa2, d5tpsb1
    automated match to d1hzhh4
    complexed with bma, fuc, gal, man, nag

Details for d5tpsb2

PDB Entry: 5tps (more details), 2.7 Å

PDB Description: structure of a fc heterodimer
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5tpsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpsb2 b.1.1.0 (B:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvctlppsrdeltknqvslscavkgfypsdiavewesngqpennykttppvld
sdgsfklvskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d5tpsb2:

Click to download the PDB-style file with coordinates for d5tpsb2.
(The format of our PDB-style files is described here.)

Timeline for d5tpsb2:

  • d5tpsb2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5tpsb1