Lineage for d5glea_ (5gle A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445599Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445600Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2445653Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2445654Protein automated matches [190499] (24 species)
    not a true protein
  7. 2445779Species Vibrio anguillarum [TaxId:882102] [340428] (4 PDB entries)
  8. 2445780Domain d5glea_: 5gle A: [340429]
    automated match to d1nf9a_

Details for d5glea_

PDB Entry: 5gle (more details), 2.1 Å

PDB Description: the structure of vibrio anguillarum775 angb-icl
PDB Compounds: (A:) Ischorismate lyase

SCOPe Domain Sequences for d5glea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5glea_ c.33.1.0 (A:) automated matches {Vibrio anguillarum [TaxId: 882102]}
maipkiasyqvlplesfptnkvdwvidpkksvvlvhdlqayflnffdktlspvpellrnv
nkvtesarsagipvvytaqpanqdpneralltdfwgvgltqdteivpevspqpediqytk
wrysafkktpllewmkeeqrdqlvivgvyghigilstaldafmldikpfvigdaiadfsk
edhmntlkyvasrsgsvksvdefidsvt

SCOPe Domain Coordinates for d5glea_:

Click to download the PDB-style file with coordinates for d5glea_.
(The format of our PDB-style files is described here.)

Timeline for d5glea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5gleb_