Lineage for d5gleb_ (5gle B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108002Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108003Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2108056Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2108057Protein automated matches [190499] (22 species)
    not a true protein
  7. 2297127Species Vibrio anguillarum [TaxId:882102] [340428] (1 PDB entry)
  8. 2297132Domain d5gleb_: 5gle B: [340433]
    automated match to d3r77b_

Details for d5gleb_

PDB Entry: 5gle (more details), 2.1 Å

PDB Description: the structure of vibrio anguillarum775 angb-icl
PDB Compounds: (B:) Ischorismate lyase

SCOPe Domain Sequences for d5gleb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gleb_ c.33.1.0 (B:) automated matches {Vibrio anguillarum [TaxId: 882102]}
maipkiasyqvlplesfptnkvdwvidpkksvvlvhdlqayflnffdktlspvpellrnv
nkvtesarsagipvvytaqpanqdpneralltdfwgvgltqdteivpevspqpediqytk
wrysafkktpllewmkeeqrdqlvivgvyghigilstaldafmldikpfvigdaiadfsk
edhmntlkyvasrsgsvksvdefissvt

SCOPe Domain Coordinates for d5gleb_:

Click to download the PDB-style file with coordinates for d5gleb_.
(The format of our PDB-style files is described here.)

Timeline for d5gleb_:

  • d5gleb_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from other chains:
(mouse over for more information)
d5glea_