Lineage for d5usib1 (5usi B:3-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024379Domain d5usib1: 5usi B:3-108 [339332]
    Other proteins in same PDB: d5usib2, d5usil2, d5usix1, d5usix2, d5usiy1, d5usiy2
    automated match to d1dn0a1

Details for d5usib1

PDB Entry: 5usi (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138
PDB Compounds: (B:) Fab vv138 Light chain

SCOPe Domain Sequences for d5usib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usib1 b.1.1.1 (B:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgipdr
fsgsgsgtdftltisrlepedfavyycqqygssppytfgqgtkvdi

SCOPe Domain Coordinates for d5usib1:

Click to download the PDB-style file with coordinates for d5usib1.
(The format of our PDB-style files is described here.)

Timeline for d5usib1:

  • d5usib1 is new in SCOPe 2.06-stable
  • d5usib1 does not appear in SCOPe 2.07