Lineage for d5usil2 (5usi L:109-215)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030416Domain d5usil2: 5usi L:109-215 [339343]
    Other proteins in same PDB: d5usib1, d5usil1, d5usix1, d5usix2, d5usiy1, d5usiy2
    automated match to d1dn0a2

Details for d5usil2

PDB Entry: 5usi (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138
PDB Compounds: (L:) Fab vv138 Light chain

SCOPe Domain Sequences for d5usil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usil2 b.1.1.2 (L:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5usil2:

Click to download the PDB-style file with coordinates for d5usil2.
(The format of our PDB-style files is described here.)

Timeline for d5usil2:

  • d5usil2 appears in periodic updates to SCOPe 2.06 starting on 2017-09-21
  • d5usil2 became obsolete in SCOPe 2.07