Lineage for d5usix1 (5usi X:2-235)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078950Species Vaccinia virus [TaxId:10245] [256246] (6 PDB entries)
  8. 2078960Domain d5usix1: 5usi X:2-235 [339340]
    Other proteins in same PDB: d5usib1, d5usib2, d5usil1, d5usil2, d5usix2, d5usiy2
    automated match to d4etqx_

Details for d5usix1

PDB Entry: 5usi (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138
PDB Compounds: (X:) IMV membrane protein

SCOPe Domain Sequences for d5usix1:

Sequence, based on SEQRES records: (download)

>d5usix1 b.74.1.0 (X:2-235) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysg

Sequence, based on observed residues (ATOM records): (download)

>d5usix1 b.74.1.0 (X:2-235) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysg

SCOPe Domain Coordinates for d5usix1:

Click to download the PDB-style file with coordinates for d5usix1.
(The format of our PDB-style files is described here.)

Timeline for d5usix1:

  • d5usix1 appears in periodic updates to SCOPe 2.06 starting on 2017-09-21
  • d5usix1 became obsolete in SCOPe 2.07