SCOPe 2.06: Domain d5x8lm2: 5x8l M:107-213

Lineage for d5x8lm2 (5x8l M:107-213)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d5x8lm2: 5x8l M:107-213 [338117]
Other proteins in same PDB: d5x8la_, d5x8lb_, d5x8lc_, d5x8ld_, d5x8le_, d5x8lk1, d5x8ll1, d5x8lm1, d5x8ln1, d5x8lo1
automated match to d1dn0a2

Details for d5x8lm2

PDB Entry: 5x8l (more details), 3.1 Å

PDB Description: pd-l1 in complex with atezolizumab

PDB Compounds: (M:) atezolizumab light chain

SCOPe Domain Sequences for d5x8lm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8lm2 b.1.1.2 (M:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5x8lm2:

Click to download the PDB-style file with coordinates for d5x8lm2.
(The format of our PDB-style files is described here.)

Timeline for d5x8lm2: