Lineage for d5x8lc_ (5x8l C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034315Domain d5x8lc_: 5x8l C: [338145]
    Other proteins in same PDB: d5x8lk2, d5x8ll2, d5x8lm2, d5x8ln2, d5x8lo2
    automated match to d3bova_

Details for d5x8lc_

PDB Entry: 5x8l (more details), 3.1 Å

PDB Description: pd-l1 in complex with atezolizumab
PDB Compounds: (C:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5x8lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8lc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekeldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnap

SCOPe Domain Coordinates for d5x8lc_:

Click to download the PDB-style file with coordinates for d5x8lc_.
(The format of our PDB-style files is described here.)

Timeline for d5x8lc_: