Lineage for d5x1bu_ (5x1b U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714802Protein automated matches [190271] (1 species)
    not a true protein
  7. 2714803Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries)
  8. 2714853Domain d5x1bu_: 5x1b U: [337720]
    Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
    automated match to d1v54h_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bu_

PDB Entry: 5x1b (more details), 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5x1bu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1bu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5x1bu_:

Click to download the PDB-style file with coordinates for d5x1bu_.
(The format of our PDB-style files is described here.)

Timeline for d5x1bu_: