Class a: All alpha proteins [46456] (290 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein automated matches [190271] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries) |
Domain d5x1bu_: 5x1b U: [337720] Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_ automated match to d1v54h_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1b (more details), 2.4 Å
SCOPe Domain Sequences for d5x1bu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1bu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5x1bu_:
View in 3D Domains from other chains: (mouse over for more information) d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_ |