Lineage for d5x1bn_ (5x1b N:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027023Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 3027024Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries)
  8. 3027089Domain d5x1bn_: 5x1b N: [337761]
    Other proteins in same PDB: d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
    automated match to d1v54a_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bn_

PDB Entry: 5x1b (more details), 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5x1bn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1bn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5x1bn_:

Click to download the PDB-style file with coordinates for d5x1bn_.
(The format of our PDB-style files is described here.)

Timeline for d5x1bn_: