SCOPe 2.06: Domain d5x1bu_: 5x1b U:

Lineage for d5x1bu_ (5x1b U:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein automated matches [190271] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187063] (19 PDB entries)

8. Domain d5x1bu_: 5x1b U: [337720]
   Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
   automated match to d1v54h_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bu_

PDB Entry: 5x1b, 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center

PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5x1bu_:

Sequence; same for both SEQRES and ATOM records:

>d5x1bu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d5x1bu_:

• d5x1bu_ is new in SCOPe 2.06-stable
  
• d5x1bu_ appears in SCOPe 2.07
  
• d5x1bu_ appears in the current release, SCOPe 2.08