SCOPe 2.07: Domain d5waub1: 5wau B:2-90

Lineage for d5waub1 (5wau B:2-90)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)

8. Domain d5waub1: 5wau B:2-90 [337619]
   Other proteins in same PDB: d5waua_, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_
   automated match to d1v54b2
   complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5waub1

PDB Entry: 5wau, 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5waub1:

Sequence; same for both SEQRES and ATOM records:

>d5waub1 f.17.2.1 (B:2-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
aypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqev
etiwtilpaiililialpslrilymmdei

Timeline for d5waub1:

• d5waub1 first appeared in SCOPe 2.06
  
• d5waub1 appears in the current release, SCOPe 2.08