Lineage for d5wauk_ (5wau K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630638Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 2630639Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 2630640Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630641Species Cow (Bos taurus) [TaxId:9913] [81420] (29 PDB entries)
  8. 2630670Domain d5wauk_: 5wau K: [337813]
    Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauj_, d5waul_, d5waum_
    automated match to d1v54k_
    complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5wauk_

PDB Entry: 5wau (more details), 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k
PDB Compounds: (K:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d5wauk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wauk_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d5wauk_:

Click to download the PDB-style file with coordinates for d5wauk_.
(The format of our PDB-style files is described here.)

Timeline for d5wauk_: