Lineage for d5wauj_ (5wau J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630532Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 2630533Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 2630534Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630535Species Cow (Bos taurus) [TaxId:9913] [81416] (51 PDB entries)
  8. 2630602Domain d5wauj_: 5wau J: [337640]
    Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauk_, d5waul_, d5waum_
    automated match to d1v54j_
    complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5wauj_

PDB Entry: 5wau (more details), 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k
PDB Compounds: (J:) cytochrome c oxidase subunit 7a1, mitochondrial

SCOPe Domain Sequences for d5wauj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wauj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d5wauj_:

Click to download the PDB-style file with coordinates for d5wauj_.
(The format of our PDB-style files is described here.)

Timeline for d5wauj_: