Class a: All alpha proteins [46456] (289 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein Cytochrome c oxidase subunit h [47696] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries) |
Domain d5wauh_: 5wau H: [337814] Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_ automated match to d1v54h_ complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn |
PDB Entry: 5wau (more details), 1.95 Å
SCOPe Domain Sequences for d5wauh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wauh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5wauh_: