SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uuia_ (5uui A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041369Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041370Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2041371Family b.22.1.1: TNF-like [49843] (15 protein domains)
  6. 2041568Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 2041569Species Human (Homo sapiens) [TaxId:9606] [49849] (16 PDB entries)
  8. 2294027Domain d5uuia_: 5uui A: [337328]
    automated match to d1a8ma_
    complexed with mtn

Details for d5uuia_

PDB Entry: 5uui (more details), 1.4 Å

PDB Description: crystal structure of spin-labeled t77c tnfa
PDB Compounds: (A:) Tumor necrosis factor

SCOPe Domain Sequences for d5uuia_:

Sequence, based on SEQRES records: (download)

>d5uuia_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqg
cpsthvllchtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
gdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records): (download)

>d5uuia_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqg
vllchtisriavsyqtkvnllsaikspakpwyepiylggvfqlekgdrlsaeinrpdyld
faesgqvyfgiial

SCOPe Domain Coordinates for d5uuia_:

Click to download the PDB-style file with coordinates for d5uuia_.
(The format of our PDB-style files is described here.)

Timeline for d5uuia_:

  • d5uuia_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03