SCOPe 2.06: Domain d5xdqa_: 5xdq A:

Lineage for d5xdqa_ (5xdq A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81432] (20 PDB entries)

8. Domain d5xdqa_: 5xdq A: [336791]
   Other proteins in same PDB: d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_
   automated match to d1v54a_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d5xdqa_

PDB Entry: 5xdq, 1.77 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state with ph 7.3 at 1.77 angstrom resolution

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5xdqa_:

Sequence; same for both SEQRES and ATOM records:

>d5xdqa_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

Timeline for d5xdqa_:

• d5xdqa_ is new in SCOPe 2.06-stable
  
• d5xdqa_ appears in SCOPe 2.07
  
• d5xdqa_ appears in the current release, SCOPe 2.08