![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81432] (20 PDB entries) |
![]() | Domain d5xdqn_: 5xdq N: [336788] Other proteins in same PDB: d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_ automated match to d1v54a_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 5xdq (more details), 1.77 Å
SCOPe Domain Sequences for d5xdqn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdqn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d5xdqn_:
![]() Domains from other chains: (mouse over for more information) d5xdqa_, d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_ |