SCOPe 2.06: Domain d5xdqp_: 5xdq P:

Lineage for d5xdqp_ (5xdq P:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries)

8. Domain d5xdqp_: 5xdq P: [336747]
   Other proteins in same PDB: d5xdqa_, d5xdqb1, d5xdqb2, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqo2, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_
   automated match to d1v54c_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d5xdqp_

PDB Entry: 5xdq, 1.77 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state with ph 7.3 at 1.77 angstrom resolution

PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5xdqp_:

Sequence; same for both SEQRES and ATOM records:

>d5xdqp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d5xdqp_:

• d5xdqp_ is new in SCOPe 2.06-stable
  
• d5xdqp_ appears in SCOPe 2.07
  
• d5xdqp_ appears in the current release, SCOPe 2.08