Lineage for d5viqa2 (5viq A:127-314)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188766Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2188887Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2188888Protein automated matches [190838] (13 species)
    not a true protein
  7. 2292001Species Rhodopseudomonas palustris [TaxId:1076] [335302] (2 PDB entries)
  8. 2292002Domain d5viqa2: 5viq A:127-314 [335303]
    Other proteins in same PDB: d5viqa1
    automated match to d2oolb1
    complexed with bla

Details for d5viqa2

PDB Entry: 5viq (more details), 1.34 Å

PDB Description: crystal structure of monomeric near-infrared fluorescent protein mirfp709
PDB Compounds: (A:) monomeric near-infrared fluorescent protein miRFP709

SCOPe Domain Sequences for d5viqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5viqa2 d.110.2.0 (A:127-314) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
sidlsgtlapalerirtagslralcddtvllfqqctgydrvmvyrfdeqghglvfsechv
pglesyfgnrypssfipqmarqlyvrqrvrvlvdvtyqpvpleprlspltgrdldmsgcf
lrsmspihlqflkdmgvratlavslvvggklwglvvchhylprfirfelraickrlaeri
atritale

SCOPe Domain Coordinates for d5viqa2:

Click to download the PDB-style file with coordinates for d5viqa2.
(The format of our PDB-style files is described here.)

Timeline for d5viqa2:

  • d5viqa2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5viqa1