SCOPe 2.08: Domain d5viqa2: 5viq A:127-314

Lineage for d5viqa2 (5viq A:127-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [335302] (2 PDB entries)

8. Domain d5viqa2: 5viq A:127-314 [335303]
   Other proteins in same PDB: d5viqa1
   automated match to d2oolb1
   complexed with bla

Details for d5viqa2

PDB Entry: 5viq, 1.34 Å

PDB Description: crystal structure of monomeric near-infrared fluorescent protein mirfp709

PDB Compounds: (A:) monomeric near-infrared fluorescent protein miRFP709

SCOPe Domain Sequences for d5viqa2:

Sequence; same for both SEQRES and ATOM records:

>d5viqa2 d.110.2.0 (A:127-314) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
sidlsgtlapalerirtagslralcddtvllfqqctgydrvmvyrfdeqghglvfsechv
pglesyfgnrypssfipqmarqlyvrqrvrvlvdvtyqpvpleprlspltgrdldmsgcf
lrsmspihlqflkdmgvratlavslvvggklwglvvchhylprfirfelraickrlaeri
atritale

Timeline for d5viqa2:

• d5viqa2 first appeared in SCOPe 2.06
  
• d5viqa2 appears in SCOPe 2.07