SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5viqa1 (5viq A:19-126)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (20 species)
    not a true protein
  7. 2291999Species Rhodopseudomonas palustris [TaxId:1076] [335300] (1 PDB entry)
  8. 2292000Domain d5viqa1: 5viq A:19-126 [335301]
    Other proteins in same PDB: d5viqa2
    automated match to d2oolb2
    complexed with bla

Details for d5viqa1

PDB Entry: 5viq (more details), 1.34 Å

PDB Description: crystal structure of monomeric near-infrared fluorescent protein mirfp709
PDB Compounds: (A:) monomeric near-infrared fluorescent protein miRFP709

SCOPe Domain Sequences for d5viqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5viqa1 d.110.3.0 (A:19-126) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
nceheeihlagsiqphgallvvsehdhrviqasanaaeflnlgsvlgvplaeidgdllik
ilphldptaegmpvavrcrignpsteycglmhrppeggliieleragp

SCOPe Domain Coordinates for d5viqa1:

Click to download the PDB-style file with coordinates for d5viqa1.
(The format of our PDB-style files is described here.)

Timeline for d5viqa1:

  • d5viqa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5viqa2