Lineage for d5viqa1 (5viq A:19-126)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (20 species)
    not a true protein
  7. 2291999Species Rhodopseudomonas palustris [TaxId:1076] [335300] (1 PDB entry)
  8. 2292000Domain d5viqa1: 5viq A:19-126 [335301]
    Other proteins in same PDB: d5viqa2
    automated match to d2oolb2
    complexed with bla

Details for d5viqa1

PDB Entry: 5viq (more details), 1.34 Å

PDB Description: crystal structure of monomeric near-infrared fluorescent protein mirfp709
PDB Compounds: (A:) monomeric near-infrared fluorescent protein miRFP709

SCOPe Domain Sequences for d5viqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5viqa1 d.110.3.0 (A:19-126) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
nceheeihlagsiqphgallvvsehdhrviqasanaaeflnlgsvlgvplaeidgdllik
ilphldptaegmpvavrcrignpsteycglmhrppeggliieleragp

SCOPe Domain Coordinates for d5viqa1:

Click to download the PDB-style file with coordinates for d5viqa1.
(The format of our PDB-style files is described here.)

Timeline for d5viqa1:

  • d5viqa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5viqa2