![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (20 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [335300] (2 PDB entries) |
![]() | Domain d5viqa1: 5viq A:19-126 [335301] Other proteins in same PDB: d5viqa2 automated match to d2oolb2 complexed with bla |
PDB Entry: 5viq (more details), 1.34 Å
SCOPe Domain Sequences for d5viqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5viqa1 d.110.3.0 (A:19-126) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} nceheeihlagsiqphgallvvsehdhrviqasanaaeflnlgsvlgvplaeidgdllik ilphldptaegmpvavrcrignpsteycglmhrppeggliieleragp
Timeline for d5viqa1: