SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d5viqa1 (5viq A:19-126)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.0: automated matches [191387] (1 protein)
not a true familyProtein automated matches [190492] (20 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:1076] [335300] (1 PDB entry) 
Domain d5viqa1: 5viq A:19-126 [335301]
Other proteins in same PDB: d5viqa2
automated match to d2oolb2
complexed with bla
Details for d5viqa1
PDB Entry: 5viq (more details), 1.34 Å
PDB Description: crystal structure of monomeric near-infrared fluorescent protein mirfp709
PDB Compounds: (A:) monomeric near-infrared fluorescent protein miRFP709SCOPe Domain Sequences for d5viqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5viqa1 d.110.3.0 (A:19-126) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
nceheeihlagsiqphgallvvsehdhrviqasanaaeflnlgsvlgvplaeidgdllik
ilphldptaegmpvavrcrignpsteycglmhrppeggliieleragp
SCOPe Domain Coordinates for d5viqa1:
Click to download the PDB-style file with coordinates for d5viqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5viqa1:
- d5viqa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08
View in 3D
