SCOPe 2.08: Domain d5umnd1: 5umn D:1-106

Lineage for d5umnd1 (5umn D:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5umnd1: 5umn D:1-106 [334801]
   Other proteins in same PDB: d5umna_, d5umnb_, d5umnc1, d5umnc2, d5umnd2, d5umne1, d5umne2, d5umnf2
   automated match to d1dn0a1
   complexed with 1pe, flc, na, nag; mutant

Details for d5umnd1

PDB Entry: 5umn, 1.97 Å

PDB Description: crystal structure of c05 vpgsgw mutant bound to h3 influenza hemagglutinin, ha1 subunit

PDB Compounds: (D:) Antibody C05, Light Chain

SCOPe Domain Sequences for d5umnd1:

Sequence; same for both SEQRES and ATOM records:

>d5umnd1 b.1.1.0 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvi

Timeline for d5umnd1:

• d5umnd1 first appeared in SCOPe 2.06
  
• d5umnd1 appears in SCOPe 2.07