Lineage for d5v3va_ (5v3v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299349Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2299409Protein automated matches [190322] (4 species)
    not a true protein
  7. 2299410Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [333034] (3 PDB entries)
  8. 2299413Domain d5v3va_: 5v3v A: [333068]
    automated match to d2bkma_
    complexed with cyn, hem, so4; mutant

Details for d5v3va_

PDB Entry: 5v3v (more details), 2.14 Å

PDB Description: crystal structure of the group ii truncated hemoglobin from bacillus anthracis: tyr26ala mutant
PDB Compounds: (A:) globin

SCOPe Domain Sequences for d5v3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v3va_ a.1.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kqpmtpfeaiggeqcieilvdtfasyvskhpdlspifpddltetarkqkqfltqylggpn
lyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhm
vntpnetgei

SCOPe Domain Coordinates for d5v3va_:

Click to download the PDB-style file with coordinates for d5v3va_.
(The format of our PDB-style files is described here.)

Timeline for d5v3va_: