Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
Protein automated matches [190322] (4 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [187467] (1 PDB entry) |
Domain d2bkma_: 2bkm A: [163114] automated match to d1ux8a_ complexed with act, hem, oxy |
PDB Entry: 2bkm (more details), 1.5 Å
SCOPe Domain Sequences for d2bkma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkma_ a.1.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} eqwqtlyeaiggeetvaklveafyrrvaahpdlrpifpddltetahkqkqfltqylggpp lytaehghpmlrarhlrfeitpkraeawlacmraamdeiglsgpareqfyhrlvltahhm vntpdhld
Timeline for d2bkma_: