SCOPe 2.06: Domain d5v3va_: 5v3v A:

Lineage for d5v3va_ (5v3v A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein automated matches [190322] (4 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [333034] (3 PDB entries)

8. Domain d5v3va_: 5v3v A: [333068]
   automated match to d2bkma_
   complexed with cyn, hem, so4; mutant

Details for d5v3va_

PDB Entry: 5v3v, 2.14 Å

PDB Description: crystal structure of the group ii truncated hemoglobin from bacillus anthracis: tyr26ala mutant

PDB Compounds: (A:) globin

SCOPe Domain Sequences for d5v3va_:

Sequence; same for both SEQRES and ATOM records:

>d5v3va_ a.1.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
kqpmtpfeaiggeqcieilvdtfasyvskhpdlspifpddltetarkqkqfltqylggpn
lyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhm
vntpnetgei

Timeline for d5v3va_:

• d5v3va_ is new in SCOPe 2.06-stable
  
• d5v3va_ appears in SCOPe 2.07
  
• d5v3va_ appears in the current release, SCOPe 2.08