PDB entry 5v3v

View 5v3v on RCSB PDB site
Description: Crystal Structure of the Group II Truncated Hemoglobin from Bacillus Anthracis: Tyr26Ala Mutant
Class: oxygen transport
Keywords: truncated hemoglobin, oxygen transport, heme protein
Deposited on 2017-03-08, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: globin
    Species: Bacillus anthracis [TaxId:1392]
    Gene: yjbI, GBAA_1209, BASH2_04647, BVB96_06425
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TQ7 (Start-131)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d5v3va_
  • Chain 'B':
    Compound: globin
    Species: Bacillus anthracis [TaxId:1392]
    Gene: yjbI, GBAA_1209, BASH2_04647, BVB96_06425
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TQ7
      • engineered mutation (25)
    Domains in SCOPe 2.07: d5v3vb_
  • Heterogens: HEM, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v3vA (A:)
    mskqpmtpfeaiggeqcieilvdtfasyvskhpdlspifpddltetarkqkqfltqylgg
    pnlyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaq
    hmvntpnetgei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v3vA (A:)
    kqpmtpfeaiggeqcieilvdtfasyvskhpdlspifpddltetarkqkqfltqylggpn
    lyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhm
    vntpnetgei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v3vB (B:)
    mskqpmtpfeaiggeqcieilvdtfasyvskhpdlspifpddltetarkqkqfltqylgg
    pnlyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaq
    hmvntpnetgei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v3vB (B:)
    pmtpfeaiggeqcieilvdtfasyvskhpdlspifpddltetarkqkqfltqylggpnly
    teehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhmvn
    tpn