Lineage for d5uwra_ (5uwr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110833Protein Ran [52609] (2 species)
  7. 2110834Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
    Uniprot P62825
  8. 2288954Domain d5uwra_: 5uwr A: [332255]
    Other proteins in same PDB: d5uwrb_
    automated match to d1qg4b_
    complexed with cl, gnp, gol, mg

Details for d5uwra_

PDB Entry: 5uwr (more details), 2.24 Å

PDB Description: crystal structure of cdc7 nes peptide (extended) in complex with crm1- ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5uwra_:

Sequence, based on SEQRES records: (download)

>d5uwra_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records): (download)

>d5uwra_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappeva
laaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d5uwra_:

Click to download the PDB-style file with coordinates for d5uwra_.
(The format of our PDB-style files is described here.)

Timeline for d5uwra_:

  • d5uwra_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23