Lineage for d5ws5b_ (5ws5 b:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634071Protein automated matches [191285] (5 species)
    not a true protein
  7. 2634087Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries)
  8. 2634125Domain d5ws5b_: 5ws5 b: [331588]
    Other proteins in same PDB: d5ws5a_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5v_, d5ws5x_, d5ws5z_
    automated match to d4il6b_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5b_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (b:) Photosystem II CP47 reaction center protein

SCOPe Domain Sequences for d5ws5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5b_ f.55.1.1 (b:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttr

SCOPe Domain Coordinates for d5ws5b_:

Click to download the PDB-style file with coordinates for d5ws5b_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5b_: