| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
| Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
| Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
| Domain d5ws5l_: 5ws5 L: [344426] Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5v_, d5ws5x_, d5ws5z_ automated match to d3a0hl_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5ws5 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws5l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws5l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d5ws5l_: