Lineage for d5ws5h_ (5ws5 H:)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) 
automatically mapped to Pfam PF00737Family f.23.33.1: PsbH-like [161026] (2 proteins)
Pfam PF00737
Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) 
Domain d5ws5h_: 5ws5 H: [331578]
Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5v_, d5ws5x_, d5ws5z_
automated match to d2axth1
complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl
Details for d5ws5h_
PDB Entry: 5ws5 (more details), 2.35 Å
PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (H:) Photosystem II reaction center protein HSCOPe Domain Sequences for d5ws5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws5h_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal
SCOPe Domain Coordinates for d5ws5h_:
Click to download the PDB-style file with coordinates for d5ws5h_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ws5h_:
View in 3D
