![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (25 PDB entries) |
![]() | Domain d5ws5k_: 5ws5 k: [331579] Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5v_, d5ws5x_, d5ws5z_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5ws5 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws5k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws5k_ f.23.36.1 (k:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d5ws5k_: