SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5us8a2 (5us8 A:190-442)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212687Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2212688Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2212689Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 protein domains)
  6. 2287234Protein automated matches [330535] (1 species)
    not a true protein
  7. 2287235Species Bordetella pertussis [TaxId:257313] [330536] (1 PDB entry)
  8. 2287274Domain d5us8a2: 5us8 A:190-442 [330575]
    Other proteins in same PDB: d5us8a1, d5us8a3, d5us8b1, d5us8b3
    automated match to d1k92a2
    complexed with adn, epe, pge, so4

Details for d5us8a2

PDB Entry: 5us8 (more details), 2.15 Å

PDB Description: 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d5us8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us8a2 d.210.1.1 (A:190-442) automated matches {Bordetella pertussis [TaxId: 257313]}
aystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrfeegqpval
ngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallfiayerlvt
gihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevtlelrrgnd
ysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklftyvktgll
apsagsalpqikd

SCOPe Domain Coordinates for d5us8a2:

Click to download the PDB-style file with coordinates for d5us8a2.
(The format of our PDB-style files is described here.)

Timeline for d5us8a2:

  • d5us8a2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02