SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5us8a1 (5us8 A:1-189)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106562Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2106563Protein automated matches [190116] (22 species)
    not a true protein
  7. 2287232Species Bordetella pertussis [TaxId:257313] [330533] (1 PDB entry)
  8. 2287273Domain d5us8a1: 5us8 A:1-189 [330574]
    Other proteins in same PDB: d5us8a2, d5us8a3, d5us8b2, d5us8b3
    automated match to d1k92a1
    complexed with adn, epe, pge, so4

Details for d5us8a1

PDB Entry: 5us8 (more details), 2.15 Å

PDB Description: 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d5us8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us8a1 c.26.2.0 (A:1-189) automated matches {Bordetella pertussis [TaxId: 257313]}
mttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeiprra
mqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaamke
dgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymrqag
fdykmsaek

SCOPe Domain Coordinates for d5us8a1:

Click to download the PDB-style file with coordinates for d5us8a1.
(The format of our PDB-style files is described here.)

Timeline for d5us8a1:

  • d5us8a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02